PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc04g049910.2.1
Common NameLOC101251575
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NF-YB
Protein Properties Length: 166aa    MW: 17776.8 Da    PI: 4.8585
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc04g049910.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB177.99.6e-5627122297
               NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyre 92 
                         reqdr+lPian++rimkk+lPan+ki+kd+k+tvqecvsefisf+tseasdkcq+ekrktingddll alatlGfedy+eplkvyl++yre
  Solyc04g049910.2.1  27 REQDRYLPIANIGRIMKKALPANGKIAKDSKDTVQECVSEFISFITSEASDKCQKEKRKTINGDDLLSALATLGFEDYIEPLKVYLTRYRE 117
                         89***************************************************************************************** PP

               NF-YB  93 legek 97 
                         +eg+ 
  Solyc04g049910.2.1 118 MEGDA 122
                         ***96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.107.6E-5223126IPR009072Histone-fold
SuperFamilySSF471131.43E-3829124IPR009072Histone-fold
PfamPF008082.9E-273296IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006154.7E-206078No hitNo description
PROSITE patternPS0068506379IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006154.7E-207997No hitNo description
PRINTSPR006154.7E-2098116No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 166 aa     Download sequence    Send to blast
MAEPASPGGG GGSHESGGDP SPQSNLREQD RYLPIANIGR IMKKALPANG KIAKDSKDTV  60
QECVSEFISF ITSEASDKCQ KEKRKTINGD DLLSALATLG FEDYIEPLKV YLTRYREMEG  120
DAKGSARVGD ASVRKDVVGC QLGSNTQFMY EGSFAQGLDY GNSQL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B6e-4726117192Transcription factor HapC (Eurofung)
4g92_B6e-4726117192Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU4578061e-121S.lycopersicum DNA sequence from clone SL_MboI-28J22 on chromosome 4, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010319840.11e-120PREDICTED: nuclear transcription factor Y subunit B-10-like
RefseqXP_004237524.11e-120PREDICTED: nuclear transcription factor Y subunit B-10-like
SwissprotQ8VYK43e-76NFYB8_ARATH; Nuclear transcription factor Y subunit B-8
TrEMBLK4BRW41e-120K4BRW4_SOLLC; Uncharacterized protein
STRINGSolyc04g049910.2.11e-119(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11124356
Representative plantOGRP16817170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G53340.14e-72nuclear factor Y, subunit B10
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]